PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G14670.1
Common NameLOC102703931
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 262aa    MW: 29186.1 Da    PI: 7.0029
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G14670.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.71.3e-27959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  krien +nrqvtfskRr g+lKKA+EL vLCda+v v+ifsstgk++ey+s
  OB02G14670.1  9 KRIENATNRQVTFSKRRGGLLKKANELAVLCDARVGVVIFSSTGKMFEYCS 59
                  79***********************************************96 PP

2K-box71.13.5e-24721712100
         K-box   2 qkssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                   q+ ++++  e ++ ++   e++++++e+e+L   +R++ G+dL++L+l +++ LeqqLe s++kiR++K++ll +q+++l++ke+ l+++n  L ++
  OB02G14670.1  72 QTVTNTHfEEINHDQQIFVEMTRMRNEMEKLDGGIRRFTGNDLSNLTLADINDLEQQLEFSVTKIRTRKHQLLNQQVDNLRRKEHILEDQNSFLCRM 168
                   5556666666778899999***************************************************************************998 PP

         K-box  98 lee 100
                   ++e
  OB02G14670.1 169 INE 171
                   875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.198161IPR002100Transcription factor, MADS-box
CDDcd002651.45E-42278No hitNo description
SuperFamilySSF554552.22E-32288IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-29323IPR002100Transcription factor, MADS-box
PfamPF003192.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-293859IPR002100Transcription factor, MADS-box
PfamPF014861.7E-2381169IPR002487Transcription factor, K-box
PROSITE profilePS5129713.28785175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0019252Biological Processstarch biosynthetic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:2000029Biological Processregulation of proanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGRGKIEIKR IENATNRQVT FSKRRGGLLK KANELAVLCD ARVGVVIFSS TGKMFEYCSP  60
TCSLRELIEH YQTVTNTHFE EINHDQQIFV EMTRMRNEME KLDGGIRRFT GNDLSNLTLA  120
DINDLEQQLE FSVTKIRTRK HQLLNQQVDN LRRKEHILED QNSFLCRMIN ENHQAAAMGG  180
GDVKMVAEMA PVLSMLTAPA SYYGGEESSS TALQLPPPLQ HAVDAAAAAA GFRLQPTQPN  240
LQDPGCSSSS FHAAAGHGLQ LW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-17185183Myocyte-specific enhancer factor 2B
1tqe_Q3e-17185183Myocyte-specific enhancer factor 2B
1tqe_R3e-17185183Myocyte-specific enhancer factor 2B
1tqe_S3e-17185183Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1095220.0AK109522.1 Oryza sativa Japonica Group cDNA clone:002-115-F04, full insert sequence.
GenBankFJ7509330.0FJ750933.1 Oryza sativa clone KCS006F06 MADS-box transcription factor 29 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646941.10.0PREDICTED: MADS-box transcription factor 29 isoform X1
RefseqXP_015689134.10.0PREDICTED: MADS-box transcription factor 29 isoform X1
SwissprotQ6H7111e-169MAD29_ORYSJ; MADS-box transcription factor 29
TrEMBLJ3LA000.0J3LA00_ORYBR; Uncharacterized protein
STRINGOB02G14670.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP185037100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.24e-50MIKC_MADS family protein